PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_234E1CDF6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 157aa    MW: 17523.6 Da    PI: 7.0269
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_234E1CDF6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY69.16.5e-2265120258
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                            +Dgy+W+KYGqK +k+ +  rsY+rC  ++C +kkkve +  dp+ + i+Y g H+h
  Traes_4AL_234E1CDF6.1  65 EDGYQWKKYGQKFIKNIQKIRSYFRCRDKRCGAKKKVEWQPGDPS-LRIVYDGAHQH 120
                            7****************************************9987.6899******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081118.21159123IPR003657WRKY domain
SuperFamilySSF1182901.31E-2061123IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.3E-2362123IPR003657WRKY domain
SMARTSM007741.5E-2164122IPR003657WRKY domain
PfamPF031062.2E-2065120IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MHAPIFLVEL KCSFIIYVID ELYLYVLVCR GSGEGERGHH GDEEEQQQAA WAEEAAGVQP  60
LVMPEDGYQW KKYGQKFIKN IQKIRSYFRC RDKRCGAKKK VEWQPGDPSL RIVYDGAHQH  120
GSPASNGGGQ DGDGAANRYD LSTQYFGGAG APTPQTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8063891e-101JQ806389.1 Hordeum vulgare WRKY transcript factor 48 (WRKY48) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231847.15e-51PREDICTED: probable WRKY transcription factor 2
TrEMBLW5DMA91e-115W5DMA9_WHEAT; Uncharacterized protein
STRINGBRADI1G13207.12e-50(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP101583444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.14e-15WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]